0
Add your answer:
Earn +20 pts
What are some thanksgiving related words that begin with the letter K?
· kitchen
What are some Thanksgiving words that start with with K?
kitchen
What are the words that start with k?
There are many words that begin with "K" if you refer to any type of dictionary it will list some as well as you could google words that begin with K.
What are some words begin with letter k?
Kabob, keepsake, ketchup and keypad begin with k. Kitchen, klaxon, knock and koala begin with k.
What are some adjectives that describe a turkey and begin with the letter K?
Some adjectives that describe a turkey and begin with the letter K are keen-eyed, keratinous (referring to the protein in their feathers), and kinetic (referring to their active movements).
What are some words that begin with the letter K?
Examples of words that begin with K are:kabobkalekaleidoscopekangarookaraokekaratkaratekarmakatydidkayakkazookeelkeenkeepkeeperkeepsakekegkelpkennelkenokeptkerchiefkernelkeroseneketchketchupkettlekettledrumkeykeyboardkeyholekeypadkeystonekeywordkhaki (the color)khakis (the garment)kickkickbackkickerkickoffkidkidnapkidnapperkidnapskidneykillkillerkilljoykilnkilokilogramkilometerkilowattkiltkimchekimonokinkindkindergartenkindlykindnesskingkingdomkingskinkkipperkisskitkitchenkitekitschkittenkittykiwiklaxonknackkneadkneeknee-padkneecapkneelknewknickersknickknackknifeknightknitknobknockknockwurstknollknotknowknowledgeknownknucklekoalakrillkumquatkangaroo KeepKellyKelpkenKeyKidkinkindKindergardenkisskitkitekithKneadKneeknightknitknittingKnivesKnotknowknownknowingknowinglyknowledgekoalakingkarot
What insulting words begin with the letter R and K?
Klutzy, kooky, rotten and rude are insulting words. They begin with K and R.
What colonial words that begin with K?
kentucky
Shouted words that begin with K?
KEEP OUT!!!
What Leadership Words begin with K?
Knowledge
What are some Thanksgiving foods that begin the the letter K?
Kentucky fried chicken, Kellogg's Mini-Wheat cereal and Keebler cookies are foods in the U.S. They begin with the letter k.
What are some Thanksgiving words that begin with the letter g?
Some Thanksgiving words include: awesome, apple pie, apples.
