Tags In Vitro Fertilization

Animals & Plants Arts & Entertainment Auto Beauty & Health Books and Literature Business Electronics Engineering & Technology Food & Drink History Hobbies Jobs & Education Law & Government Math People & Society Science Social Studies Sports Travel & Places

0

Subjects>Beauty & Health>Health Conditions

What are the good things about ivf?

Updated: 9/7/2023

Wiki User

∙ 13y ago

Best Answer

yes it allows couples to concieve if not possible in the first place apart from the cost yes it is a good thing

Wiki User

∙ 12y ago

This answer is:

More answers

Wiki User

∙ 10y ago

There are benefits, such as:

It allows infertile people to have children
Women without a partner who really want a kid can have one

This answer is:

Wiki User

∙ 13y ago

well a person who cant have a baby can have one

This answer is:

Add your answer:

Earn +20 pts

Q: What are the good things about ivf?

Write your answer...

Submit

Still have questions?

imp

Related questions

What is ivf for pandas?

It's the same things as for a human ;-)

ivf?

In vitro fertilization

What is the role of a fertility specialist in IVF?

i'm not sure, but good luck in finding out

Can i do anything to help implantation?

if you're doing IVF accupuncture is very good for implantation.

Please suggest any Good Gynecologist or IVF doctor in Dubai with experience?

Dr. Mazen Dayef IVF Clinic is best option for you. Call: +971 50 555 1964

Should a Catholic person have IVF?

No. IVF is a mortal sin.

Is 950 beta hcg level positive after ivf treatment?

Yes. It is a very good number.

Who is the stakeholder in IVF?

Ivf clinicsgynecologistspsychiatristmidwivesclericsother countries progressing in biotechnologypharmaceutical companies

IVF CENTRE IN CHENNAI Aims Fertility?

Top 5 Best IVF Centre in Chennai with High Success Rate 2020 Best IVF Centres in Chennai Here you can find the... Top 10 Best Surrogacy Centres in Chennai with High Success Rate 2020 Surrogacy is a process involves the insemination of the male... 5 Best IVF Doctors in Chennai with High Success Rate 2020 Best IVF Doctor in Chennai Below are the Top IVF... 5 Best Surrogacy Doctors in Chennai with High Success Rate 2020 Best IVF Doctor in Chennai Below are the Top IVF... IVF Cost in Chennai: Test Tube Baby Cost in Chennai, Low-cost IVF Centres in Chennai Table of Contents What Is The IVF Cost In Chennai?...

Best IVF center in Jaipur?

RITU IVF is the best IVF center in Jaipur. If you are suffering from infertility issues you can consult with the best IVF doctor in Jaipur , Dr. Ritu Agarwal. Ritu IVF provides infertility treatments, testing, and therapy at a 90% success rate. A team of expert doctors and helping staff help couples to fulfill their dream of becoming parents. They offer a range of options like IVF, IUI, ICSI, etc. So trust Ritu IVF and start your journey of fertility treatment. Choose the best IVF hospital in Jaipur.

Can a hiv infected female have a successful ivf procedure?

Yes she can have a successful IVF procedure.

Will medical insurance pay for IVF?

Some insurance plans pay for IVF, and others do not.

Trending Questions

What is the cause of orangey oily stool? How does lack of role models lead to HIV and teen pregnancy? What do hawlks fear? Could a girl get herself pregnant? What is the CPT code for VATS surgical removal of upper and amp middle lobes of right lung? What should an child eat when he or she has a fevor? What is the enzyme found in the synaptic space between a neuron and a muscle fiber that breaks down the excitatory neurotransmitter chemical that originally caused the muscle fiber to contract called? What does great day in the morning mean? How do you lose weight if you have a tyroid condition? Do other animals have a larynx? When you inhale air goes through the what before it enters the bronchi? Is it normal for a 12 years to have 2 different size breasts one is growing and the other is not? What causes the body to produce antibodies? Are there any homeopathic muscle relaxant's? How do you get the brush pressure at macromedia flash 8? How did soldiers get frostbite? Why do older men live longer with younger wives? How do you make your own bikini padding And is there a certain kind of padding you should use? Why is my menstrual cup not working even though it's definitely open? How can infections be passed on?

Still have questions?

imp

Previously Viewed

What are the good things about ivf?

Unanswered Questions

Was wäre, wenn wir unter Wasser leben müssten? How often should NDT equipment be calibrated? How do you measure weight with a load cell? What ingredients are typically used in Mixture Namkeen? Is Mixture Namkeen spicy, and are there different flavor options? What health issues are common in Himalayan kittens in Bangalore? Do you use OEM (Original Equipment Manufacturer) glass for replacements? Do removalists offer storage solutions?

Resources

Top Categories

Product

Company

Copyright ©2024 Infospace Holdings LLC, A System1 Company. All Rights Reserved. The material on this site can not be reproduced, distributed, transmitted, cached or otherwise used, except with prior written permission of Answers.